PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN25241.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 336aa    MW: 37602.6 Da    PI: 5.0682
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN25241.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.76.3e-142269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
       KHN25241.1 22 KGLWSPEEDDKLMNYMLNSGQGCWSDVARNAGLQRCGKSCRLRWINYL 69
                     678*******************************************97 PP

2Myb_DNA-binding51.91.8e-1675118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+++++ +lG++ W+ Ia++++ gRt++++k++w++
       KHN25241.1  75 RGAFSQQEEELIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 118
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0891769IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-231772IPR009057Homeodomain-like
SuperFamilySSF466892.3E-2720116IPR009057Homeodomain-like
SMARTSM007172.4E-92171IPR001005SANT/Myb domain
PfamPF002491.3E-122269IPR001005SANT/Myb domain
CDDcd001673.74E-82569No hitNo description
PROSITE profilePS5129425.72370124IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.7E-2673125IPR009057Homeodomain-like
SMARTSM007176.8E-1674122IPR001005SANT/Myb domain
PfamPF002494.2E-1575118IPR001005SANT/Myb domain
CDDcd001671.55E-1177117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MRKPEVSGNN NNNNNINNKL RKGLWSPEED DKLMNYMLNS GQGCWSDVAR NAGLQRCGKS  60
CRLRWINYLR PDLKRGAFSQ QEEELIIHLH SLLGNRWSQI AARLPGRTDN EIKNFWNSTI  120
KKRLKNMSSN TSPNGSESSY EPNNRDLNMA GFTTSNTQDQ QHADFMPMFN SSSQSPSMHA  180
MVLNSIIDRL PMLEHGLNMP CSGGFFNSTG PCFSSSQSGV DNKGIYLENG GVFGSVNIGA  240
EGDVYVPPLE SVSTTSDHNL KVESTCNTDT NNSYFDDINS ILLNNCNINS NNKRAENRAG  300
GVENLFQEEL TIGEWDLEEL MKDVSSFPFL DFSNIQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-281612421128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539482.10.0PREDICTED: transcription factor MYB46
SwissprotQ9LXV22e-72MYB46_ARATH; Transcription factor MYB46
TrEMBLA0A0B2QUG20.0A0A0B2QUG2_GLYSO; Transcription factor MYB46
TrEMBLA0A0R4J4P20.0A0A0R4J4P2_SOYBN; Uncharacterized protein
STRINGGLYMA12G06180.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.18e-64myb domain protein 46
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]